(data stored in ACNUC30630 zone)

EMBL: AP010890.PE628

AP010890.PE628       Location/Qualifiers
FT   CDS             800101..800907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70775"
FT                   /db_xref="GOA:E8MSN1"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN1"
FT                   /protein_id="BAJ70775.1"
FT                   /translation="MVVRSWSELDFDNVCSNAKVFGFDLDNTLASSKQPMKPAMIERFC
FT                   ALLDHTVVALISGGGMAVVTSQVLDVLTPNARRGNLHVMPTSGSRYYRWDGTQWALVYA
FT                   HDLSEATVAAVSESLERHARELGLWEQQVWGPRIENRGSQITFSALGQFAPVAAKQAWD
FT                   RDNTKKQALVEAVKADLPHMRVRAGGYTSVDVSECGIDKAYAVRKLTQTLGIRADEMVF
FT                   VGDRMTPTGNDYPAVEAGAIGVRVENPQDTVQLLDALLARFDTPAR"
     MVVRSWSELD FDNVCSNAKV FGFDLDNTLA SSKQPMKPAM IERFCALLDH TVVALISGGG        60
     MAVVTSQVLD VLTPNARRGN LHVMPTSGSR YYRWDGTQWA LVYAHDLSEA TVAAVSESLE       120
     RHARELGLWE QQVWGPRIEN RGSQITFSAL GQFAPVAAKQ AWDRDNTKKQ ALVEAVKADL       180
     PHMRVRAGGY TSVDVSECGI DKAYAVRKLT QTLGIRADEM VFVGDRMTPT GNDYPAVEAG       240
     AIGVRVENPQ DTVQLLDALL ARFDTPAR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page