(data stored in ACNUC30630 zone)

EMBL: AP010890.PE667

AP010890.PE667       Location/Qualifiers
FT   CDS             complement(849994..851475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70814"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS0"
FT                   /protein_id="BAJ70814.1"
FT                   /translation="MRQGFDNEKYIELQAANIRKRIAQFGGKLYLEFGGKLFDDYHASR
FT                   VLPGFEPDTKFRMLESLVDDVEIVIAINANHIEKGKTRGDLGIPYDEDVLRLIDVFRSR
FT                   GFLVGSVVLTQYANQPAADAYRHRLEQLGVTCRLHYPIAGYPHDIERIVSDDGYGRNEY
FT                   IETSRPLVVVTAPGPGSGKLATCLSQLYHEHQRGIDAGYAKYETFPIWNLPLNHPVNIA
FT                   YEAATVDLDDANIIDPFHLEAYGETTVNYNRDVEAFPVLKAMMERIMGESPYQSPTDMG
FT                   VNMAGYAIVDDDACRDAARLEIVRRYFAAAVHLKRTGTGEEQVERLRSIMNRAGVTPDL
FT                   SPARAVALEKEAATGAPAGAMVLPDGHVVTGKTGDLLGAASALLMHALKAVTGVDETIP
FT                   VIDDAAIEPICRLKTEHLNSVNRRLHSDETLIALSITSATSPVAARVIDGLKQLQGCDA
FT                   FFSVIISSTDEALYRKLGINVCCEPKYERVSLYHR"
     MRQGFDNEKY IELQAANIRK RIAQFGGKLY LEFGGKLFDD YHASRVLPGF EPDTKFRMLE        60
     SLVDDVEIVI AINANHIEKG KTRGDLGIPY DEDVLRLIDV FRSRGFLVGS VVLTQYANQP       120
     AADAYRHRLE QLGVTCRLHY PIAGYPHDIE RIVSDDGYGR NEYIETSRPL VVVTAPGPGS       180
     GKLATCLSQL YHEHQRGIDA GYAKYETFPI WNLPLNHPVN IAYEAATVDL DDANIIDPFH       240
     LEAYGETTVN YNRDVEAFPV LKAMMERIMG ESPYQSPTDM GVNMAGYAIV DDDACRDAAR       300
     LEIVRRYFAA AVHLKRTGTG EEQVERLRSI MNRAGVTPDL SPARAVALEK EAATGAPAGA       360
     MVLPDGHVVT GKTGDLLGAA SALLMHALKA VTGVDETIPV IDDAAIEPIC RLKTEHLNSV       420
     NRRLHSDETL IALSITSATS PVAARVIDGL KQLQGCDAFF SVIISSTDEA LYRKLGINVC       480
     CEPKYERVSL YHR                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page