(data stored in ACNUC30630 zone)

EMBL: AP010890.PE679

AP010890.PE679       Location/Qualifiers
FT   CDS             860218..860544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70826"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST2"
FT                   /protein_id="BAJ70826.1"
FT                   /translation="MLVPQPLPDPGRGMPLLAPVRAILREPLLDHGQIRVDHRRARLSH
FT                   RRHGRQILLREVLTHRRLADMCFPRDRRDGFPVPPQTTDRLYLGHADHNPFRSFLAEIQ
FT                   APSS"
     MLVPQPLPDP GRGMPLLAPV RAILREPLLD HGQIRVDHRR ARLSHRRHGR QILLREVLTH        60
     RRLADMCFPR DRRDGFPVPP QTTDRLYLGH ADHNPFRSFL AEIQAPSS                    108
//

If you have problems or comments...

PBIL Back to PBIL home page