(data stored in ACNUC30630 zone)

EMBL: AP010890.PE681

AP010890.PE681       Location/Qualifiers
FT   CDS             complement(862423..862740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70828"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST4"
FT                   /protein_id="BAJ70828.1"
FT                   /translation="MASDVFESYSAGTETKPQINQDAVRIMKELYGIDMEKTQYSKLIS
FT                   DIPAPDIAISMGCNVGCPFIGRAFDDNWGLEDPTGSEDQVFVEIIREIEKRILQLKQSL
FT                   I"
     MASDVFESYS AGTETKPQIN QDAVRIMKEL YGIDMEKTQY SKLISDIPAP DIAISMGCNV        60
     GCPFIGRAFD DNWGLEDPTG SEDQVFVEII REIEKRILQL KQSLI                       105
//

If you have problems or comments...

PBIL Back to PBIL home page