(data stored in ACNUC30630 zone)

EMBL: AP010890.PE70

AP010890.PE70        Location/Qualifiers
FT   CDS             88201..88722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70217"
FT                   /db_xref="GOA:E8MWR4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR4"
FT                   /protein_id="BAJ70217.1"
FT                   /translation="MTIRIEAYDRLPAAARAIREQVFIRERDWRPEFDEWDAASVHLLV
FT                   FDSDNDAPNRPGSSAQLASRSQPIQPSQNHPVATCRFYADPDHPDQPGRYIIARLAVLP
FT                   EAQGRHIGSRLLADAERRIAQAGGTMTAVHSENDHYKFYEQCGYRLTDEVYEGGRHGWL
FT                   IKDLILGSEN"
     MTIRIEAYDR LPAAARAIRE QVFIRERDWR PEFDEWDAAS VHLLVFDSDN DAPNRPGSSA        60
     QLASRSQPIQ PSQNHPVATC RFYADPDHPD QPGRYIIARL AVLPEAQGRH IGSRLLADAE       120
     RRIAQAGGTM TAVHSENDHY KFYEQCGYRL TDEVYEGGRH GWLIKDLILG SEN              173
//

If you have problems or comments...

PBIL Back to PBIL home page