(data stored in ACNUC30630 zone)

EMBL: AP010890.PE8

AP010890.PE8         Location/Qualifiers
FT   CDS             11406..12119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70155"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK2"
FT                   /protein_id="BAJ70155.1"
FT                   /translation="MKNTIIRAAGVLLAASMIFGGAAATASAAEATSPSTGTTSSTQAA
FT                   ESINREWVLNPANNTELAALGTIQGGSQTFDGLTIDATANGAKFAPRANDTQINAGTII
FT                   SIPVPAHTNTATITLALSGGTTTITADAGEVSSDNTVIALPAAESARTVNVTFTAQTYL
FT                   NGIALAEQQPEPEFPGTPTVAAKDTNWDFTETGIDRPAVQGLPTTTKASPSTLGRKAPS
FT                   STRVLPRQAAAAILR"
     MKNTIIRAAG VLLAASMIFG GAAATASAAE ATSPSTGTTS STQAAESINR EWVLNPANNT        60
     ELAALGTIQG GSQTFDGLTI DATANGAKFA PRANDTQINA GTIISIPVPA HTNTATITLA       120
     LSGGTTTITA DAGEVSSDNT VIALPAAESA RTVNVTFTAQ TYLNGIALAE QQPEPEFPGT       180
     PTVAAKDTNW DFTETGIDRP AVQGLPTTTK ASPSTLGRKA PSSTRVLPRQ AAAAILR          237
//

If you have problems or comments...

PBIL Back to PBIL home page