(data stored in ACNUC30630 zone)

EMBL: AP010890.PE84

AP010890.PE84        Location/Qualifiers
FT   CDS             107837..108232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70231"
FT                   /db_xref="GOA:E8MWS8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS8"
FT                   /protein_id="BAJ70231.1"
FT                   /translation="MMWMICLFGGLGAMARYVLDVSIQQGWNRENRRTNRNFPLSTLVI
FT                   NGVASLCAGIAMMSYYSQSVDMDTVMMFVVGFLGGFSTFSTALNEVVSLIRQRRFTLAL
FT                   GYGIATVAVPLICVAAGFGIALLANPA"
     MMWMICLFGG LGAMARYVLD VSIQQGWNRE NRRTNRNFPL STLVINGVAS LCAGIAMMSY        60
     YSQSVDMDTV MMFVVGFLGG FSTFSTALNE VVSLIRQRRF TLALGYGIAT VAVPLICVAA       120
     GFGIALLANP A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page