(data stored in ACNUC30630 zone)

EMBL: AP010890.PE97

AP010890.PE97        Location/Qualifiers
FT   CDS             123947..125584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0097"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70244"
FT                   /db_xref="GOA:E8MWU1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU1"
FT                   /protein_id="BAJ70244.1"
FT                   /translation="MLEPYVRPGIDDRPDLDKVLSPEDKAAVARLAIKNRRRPPEASAD
FT                   QPEAQAVRLASAGSSAAAAAAASVDTPAPDMSSAYLDMRDPMVAVNGQRPTAGQVSRLN
FT                   WGFFAASILVGAPWVALNTIAMPNAIARTFGYDTAVAGHIAINPATGRPLPVATELAMP
FT                   LAVLVIVGVVASMFAMPLISVLSDHTRTPLGRRTPWMVGGGLLCALITLILGQNIGIIV
FT                   LCIFWVFLQFAYAMLSVPLTSAISERVPDKFRPRIERWHGIGVMLGQALGVCMGALGVM
FT                   FNSFAPFSYTAVLFAVSGIATVLILPKEPSSAEQPNQLFDRSQVLDQLRPPAHAPEFSR
FT                   VFAARTCMMAGVGLTGVFLWYLVRFWVYGKAVVLTSAPLTIPAGFLIAGMAVATLIGAA
FT                   LASWAAGPISERIEEKNIPVARVVAGACLLYAAGLALAWGLGVWSTGTARENGMLLFAL
FT                   ISGFAFGVYDSLGLELVMDSLPDPRRAGHDLGIYALANSAGLALAAIIGALLVNAFEHS
FT                   FGYYLLFPSAIVMVLLAGIVTLTTKSAE"
     MLEPYVRPGI DDRPDLDKVL SPEDKAAVAR LAIKNRRRPP EASADQPEAQ AVRLASAGSS        60
     AAAAAAASVD TPAPDMSSAY LDMRDPMVAV NGQRPTAGQV SRLNWGFFAA SILVGAPWVA       120
     LNTIAMPNAI ARTFGYDTAV AGHIAINPAT GRPLPVATEL AMPLAVLVIV GVVASMFAMP       180
     LISVLSDHTR TPLGRRTPWM VGGGLLCALI TLILGQNIGI IVLCIFWVFL QFAYAMLSVP       240
     LTSAISERVP DKFRPRIERW HGIGVMLGQA LGVCMGALGV MFNSFAPFSY TAVLFAVSGI       300
     ATVLILPKEP SSAEQPNQLF DRSQVLDQLR PPAHAPEFSR VFAARTCMMA GVGLTGVFLW       360
     YLVRFWVYGK AVVLTSAPLT IPAGFLIAGM AVATLIGAAL ASWAAGPISE RIEEKNIPVA       420
     RVVAGACLLY AAGLALAWGL GVWSTGTARE NGMLLFALIS GFAFGVYDSL GLELVMDSLP       480
     DPRRAGHDLG IYALANSAGL ALAAIIGALL VNAFEHSFGY YLLFPSAIVM VLLAGIVTLT       540
     TKSAE                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page