(data stored in ACNUC10821 zone)

EMBL: AP010958.AROP

AP010958.AROP        Location/Qualifiers
FT   CDS             complement(121779..123152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ECO103_0112"
FT                   /product="aromatic amino acid transporter AroP"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28990"
FT                   /db_xref="GOA:C8U1I2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1I2"
FT                   /protein_id="BAI28990.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQATVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAAVLVIMLMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH"
     MMEGQQHGEQ LKRGLKNRHI QLIALGGAIG TGLFLGSASV IQSAGPGIIL GYAIAGFIAF        60
     LIMRQLGEMV VEEPVAGSFS HFAYKYWGSF AGFASGWNYW VLYVLVAMAE LTAVGKYIQF       120
     WYPEIPTWVS AAVFFVVINA INLTNVKVFG EMEFWFAIIK VIAVVAMIIF GGWLLFSGNG       180
     GPQATVSNLW DQGGFLPHGF TGLVMMMAII MFSFGGLELV GITAAEADNP EQSIPKATNQ       240
     VIYRILIFYI GSLAVLLSLM PWTRVTADTS PFVLIFHELG DTFVANALNI VVLTAALSVY       300
     NSCVYCNSRM LFGLAQQGNA PKALASVDKR GVPVNTILVS ALVTALCVLI NYLAPESAFG       360
     LLMALVVSAL VINWAMISLA HMKFRRAKQE QGVVTRFPAL LYPLGNWICL LFMAAVLVIM       420
     LMTPGMAISV YLIPVWLIVL GIGYLFKEKT AKAVKAH                                457
//

If you have problems or comments...

PBIL Back to PBIL home page