(data stored in ACNUC10821 zone)

EMBL: AP010958.CLPP

AP010958.CLPP        Location/Qualifiers
FT   CDS             465266..465889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECO103_0414"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="subunit of ClpA-ClpP and ClpX-ClpP; ATP-dependent
FT                   serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29282"
FT                   /db_xref="GOA:C8U2C4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2C4"
FT                   /protein_id="BAI29282.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     MSYSGERDNF APHMALVPMV IEQTSRGERS FDIYSRLLKE RVIFLTGQVE DHMANLIVAQ        60
     MLFLEAENPE KDIYLYINSP GGVITAGMSI YDTMQFIKPD VSTICMGQAA SMGAFLLTAG       120
     AKGKRFCLPN SRVMIHQPLG GYQGQATDIE IHAREILKVK GRMNELMALH TGQSLEQIER       180
     DTERDRFLSA PEAVEYGLVD SILTHRN                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page