(data stored in ACNUC10821 zone)

EMBL: AP010958.CRCB

AP010958.CRCB        Location/Qualifiers
FT   CDS             complement(695233..695616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="ECO103_0632"
FT                   /product="predicted inner membrane protein"
FT                   /note="associated with chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29495"
FT                   /db_xref="GOA:C8U2Y7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Y7"
FT                   /protein_id="BAI29495.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     MLQLLLAVFI GGGTGSVARW LLSMRFNPLH QAIPLGTLAA NLIGAFIIGM GFAWFSRMTN        60
     IDPVWKVLIT TGFCGGLTTF STFSAEVVFL LQEGRFGWAL LNVFVNLLGS FAMTALAFWL       120
     FSASTAH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page