(data stored in ACNUC10821 zone)

EMBL: AP010958.DKSA

AP010958.DKSA        Location/Qualifiers
FT   CDS             complement(161547..162002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECO103_0145"
FT                   /product="DNA-binding transcriptional regulator DskA of
FT                   rRNA transcription, DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29023"
FT                   /db_xref="GOA:C8U1L5"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1L5"
FT                   /protein_id="BAI29023.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
     MQEGQNRKTS SLSILAIAGV EPYQEKPGEE YMNEAQLAHF RRILEAWRNQ LRDEVDRTVT        60
     HMQDEAANFP DPVDRAAQEE EFSLELRNRD RERKLIKKIE KTLKKVEDED FGYCESCGVE       120
     IGIRRLEARP TADLCIDCKT LAEIREKQMA G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page