(data stored in ACNUC10821 zone)

EMBL: AP010958.DNAQ

AP010958.DNAQ        Location/Qualifiers
FT   CDS             236801..237532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECO103_0209"
FT                   /product="DNA polymerase III, epsilon subunit DnaQ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29085"
FT                   /db_xref="GOA:C8U1S7"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1S7"
FT                   /protein_id="BAI29085.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEL
FT                   AAHEARLDLVEKKGGSCLWRA"
     MSTAITRQIV LDTETTGMNQ IGAHYEGHKI IEIGAVEVVN RRLTGNNFHV YLKPDRLVDP        60
     EAFGVHGIAD EFLLDKPTFA EVADEFMDYI RGAELVIHNA AFDIGFMDYE FSLLKRDIPK       120
     TNTFCKVTDS LAVARKMFPG KRNSLDALCA RYEIDNSKRT LHGALLDAQI LAEVYLAMTG       180
     GQTSMAFAME GETQQQQGEA TIQRIVRQAS KLRVVFATDE ELAAHEARLD LVEKKGGSCL       240
     WRA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page