(data stored in ACNUC10821 zone)

EMBL: AP010958.FDRA

AP010958.FDRA        Location/Qualifiers
FT   CDS             553874..555541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="ECO103_0490"
FT                   /product="predicted acyl-CoA synthetase"
FT                   /note="contains NAD(P)-binding Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29357"
FT                   /db_xref="GOA:C8U2J9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2J9"
FT                   /protein_id="BAI29357.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQSLTQ
FT                   VRRWDSACQKLSDASLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAGTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEMLAFVSKPPAEAVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVACDENVWFASSLDEAARLACLLSRVTARRNAITPASSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDTHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQ
FT                   LIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIRPLSPATQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
     MIHAFIKKGC FQDSVSLMII SRKLSESENV DDVSVMMGTP ANKALLDTTG FWHDDFNNAT        60
     PNDICVAIRS EAADAGIAQA IMQQLEEALK QLAQGSGSSQ SLTQVRRWDS ACQKLSDASL       120
     ALISVAGEYA AELANQALDR NLNVMMFSDN VTLEDEIQLK TRAREKGLLV MGPDCGTSMI       180
     AGTPLAFANV MPEGNIGVIG ASGTGIQELC SQIALAGEGI THAIGLGGRD LSREVGGISA       240
     LTALEMLSAD EKSEMLAFVS KPPAEAVRLK IVNAMKATGK PTVALFLGYT PAVACDENVW       300
     FASSLDEAAR LACLLSRVTA RRNAITPASS GFICGLYTGG TLAAEAAGLL AGHLGVEADD       360
     THHHGMMLDA DGHQIIDLGD DFYTVGRPHP MIDPALRNQL IADLGAKPQV RVLLLDVVIG       420
     FGATADPAAS LVSAWQKACA ARSDNQPLYA IATVTGTERD PQCRSQQIAT LEDAGIAVVS       480
     SLPEATLLAA ALIRPLSPAT QQHTPSLLEN VAVINIGLRS FALELQSASK PVVHYQWSPV       540
     AGGNKKLARL LERLQ                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page