(data stored in ACNUC10821 zone)

EMBL: AP010958.FEPE

AP010958.FEPE        Location/Qualifiers
FT   CDS             656046..657179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="ECO103_0595"
FT                   /product="ferric enterobactin transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29459"
FT                   /db_xref="GOA:C8U2V1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2V1"
FT                   /protein_id="BAI29459.1"
FT                   /translation="MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMA
FT                   VVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAF
FT                   NLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKK
FT                   DEPSLYTSWTLSFTALTSEEAQTVLSGYIDYISTLVVKESLENVRNKLEIKTQFEKEKL
FT                   AQDRIKTKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERK
FT                   LEIEKAVTDVAELNGELRNRQYLVEQLTKAHVNDVNFTPFKYQLSPSLPVKKDGPGKAI
FT                   IVILSALIGGMVACGGVLLRYAMASRKQDAMMADHLV"
     MSSLNIKQGS DAHFPDYPLA SPSNNEIDLL NLISVLWRAK KTVMAVVFAF ACAGLLISFI        60
     LPQKWTSAAV VTPPEPVQWQ ELEKTFTKLR VLDLDIKIDR TEAFNLFIKK FQSVSLLEEY       120
     LRSSPYVMDQ LKEAKIDELD LHRAIVALSE KMKAVDDNAS KKKDEPSLYT SWTLSFTALT       180
     SEEAQTVLSG YIDYISTLVV KESLENVRNK LEIKTQFEKE KLAQDRIKTK NQLDANIQRL       240
     NYSLDIANAA GIKKPVYSNG QAVKDDPDFS ISLGADGIER KLEIEKAVTD VAELNGELRN       300
     RQYLVEQLTK AHVNDVNFTP FKYQLSPSLP VKKDGPGKAI IVILSALIGG MVACGGVLLR       360
     YAMASRKQDA MMADHLV                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page