(data stored in SCRATCH zone)

EMBL: AP010958.FHUD

AP010958.FHUD        Location/Qualifiers
FT   CDS             171973..172863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECO103_0152"
FT                   /product="iron-hydroxamate transporter subunit FhuD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29030"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1M2"
FT                   /protein_id="BAI29030.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAHYEDFIR
FT                   SMKPRFVKRGERPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
     MSGLPLISRR RLLTAMALSP LLWQMNTAHA AAIDPNRIVA LEWLPVELLL ALGIVPYGVA        60
     DTINYRLWVS EPPLPDSVID VGLRTEPNLE LLTEMKPSFM VWSAGYGPSP EMLARIAPGR       120
     GFNFSDGKQP LAMARKSLTE MADLLNLQSA AETHLAHYED FIRSMKPRFV KRGERPLLLT       180
     TLIDPRHMLV FGPNSLFQEI LDEYGIPNAW QGETNFWGST AVSIDRLAAY KDVDVLCFDH       240
     DNSKDMDALM ATPLWQAMPF VRAGRFQRVP AVWFYGATLS AMHFVRVLDN AIGGKA           296
//

If you have problems or comments...

PBIL Back to PBIL home page