(data stored in ACNUC10821 zone)

EMBL: AP010958.FTSL

AP010958.FTSL        Location/Qualifiers
FT   CDS             92749..93114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ECO103_0085"
FT                   /product="membrane bound cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28963"
FT                   /db_xref="GOA:C8U1F5"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1F5"
FT                   /protein_id="BAI28963.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSMGSHE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page