(data stored in ACNUC10821 zone)

EMBL: AP010958.FTSQ

AP010958.FTSQ        Location/Qualifiers
FT   CDS             104872..105702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ECO103_0095"
FT                   /product="membrane anchored protein FtsQ"
FT                   /note="involved in growth of wall at septum"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28973"
FT                   /db_xref="GOA:C8U1G5"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1G5"
FT                   /protein_id="BAI28973.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
     MSQAALNTRN SEEEVSSRRN NGTRLAGILF LLTVLTTVLV SGWVVLGWME DAQRLPLSKL        60
     VLTGERHYTR NDDIRQSILA LGEPGTFMTQ DVNIIQTQIE QRLPWIKQVS VRKQWPDELK       120
     IHLVEYVPIA RWNDQHMVDA EGNTFSVPPD RTSKQVLPML YGPEGSANEV LQGYREMGQM       180
     LAKDRFTLKE AAMTARRSWQ LTLNNDIKLN LGRGDTMKRL ARFVELYPVL QQQAQTDGKR       240
     ISYVDLRYDS GAAVGWAPLP PEESTQQQNQ AQAEQQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page