(data stored in ACNUC10821 zone)

EMBL: AP010958.GLNK

AP010958.GLNK        Location/Qualifiers
FT   CDS             481188..481526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="ECO103_0427"
FT                   /product="nitrogen assimilation regulatory protein GlnK for
FT                   GlnL, GlnE, and AmtB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29295"
FT                   /db_xref="GOA:C8U2D7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2D7"
FT                   /protein_id="BAI29295.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
     MKLVTVIIKP FKLEDVREAL SSIGIQGLTV TEVKGFGRQK GHAELYRGAE YSVNFLPKVK        60
     IDVAIADDQL DEVIDIVSKA AYTGKIGDGK IFVAELQRVI RIRTGEADEA AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page