(data stored in ACNUC10821 zone)

EMBL: AP010958.HOFC/HCPA

AP010958.HOFC/HCPA   Location/Qualifiers
FT   CDS             complement(116123..117325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC/hcpA"
FT                   /locus_tag="ECO103_0106"
FT                   /product="assembly protein HofC in type IV pilin
FT                   biogenesis, transmembrane protein"
FT                   /note="component of type IV pilin biogenesis pathway,
FT                   probable chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28984"
FT                   /db_xref="GOA:C8U1H6"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1H6"
FT                   /protein_id="BAI28984.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRALLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVL
FT                   FGFLLAIANKLLMRRPTWLIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNTGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     MASKQLWRWH GITGDGNAQD GMLWAESRAL LLMALQQQMV TPLSLKRIAI NSAQWRGDKS        60
     AEVIHQLATL LKAGLTLSEG LALLAEQHPS KQWQALLQSL AHDLEQGIAF SNALLPWSEV       120
     FPPLYQAMIR TGELTGKLDE CCFELARQQK AQRQLTDKVK SALRYPIIIL AMAIMVVVAM       180
     LHFVLPEFAA IYKTFNTPLP ALTQGIMTLA DFSGEWSWLL VLFGFLLAIA NKLLMRRPTW       240
     LIVRQKLLLR IPIMGSLMRG QKLTQIFTIL ALTQSAGITF LQGVESVRET MRCPYWVQLL       300
     TQIQHDISNG HPIWLALKNT GEFSPLCLQL VRTGEASGSL DLMLDNLAHH HRDNTMALAD       360
     NLAALLEPAL LIITGGIIGT LVVAMYLPIF HLGDAMSGMG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page