(data stored in ACNUC10821 zone)

EMBL: AP010958.HOKC1

AP010958.HOKC1       Location/Qualifiers
FT   CDS             complement(16680..16832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokC1"
FT                   /locus_tag="ECO103_0017"
FT                   /product="small toxic membrane peptide HokC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28900"
FT                   /db_xref="GOA:C8U192"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:C8U192"
FT                   /protein_id="BAI28900.1"
FT                   /translation="MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFT
FT                   AYESE"
     MKQHKAMIVA LIVICITAVV AALVTRKDLC EVHIRTGQTE VAVFTAYESE                   50
//

If you have problems or comments...

PBIL Back to PBIL home page