(data stored in ACNUC10821 zone)

EMBL: AP010958.HUPB

AP010958.HUPB        Location/Qualifiers
FT   CDS             470040..470312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="ECO103_0417"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29285"
FT                   /db_xref="GOA:C8U2C7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2C7"
FT                   /protein_id="BAI29285.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
     MNKSQLIDKI AAGADISKAA AGRALDAIIA SVTESLKEGD DVALVGFGTF AVKERAARTG        60
     RNPQTGKEIT IAAAKVPSFR AGKALKDAVN                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page