(data stored in ACNUC10821 zone)

EMBL: AP010958.LEUD

AP010958.LEUD        Location/Qualifiers
FT   CDS             complement(80565..81170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECO103_0073"
FT                   /product="3-isopropylmalate isomerase subunit LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28951"
FT                   /db_xref="GOA:C8U1E3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1E3"
FT                   /protein_id="BAI28951.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMN"
     MAEKFIKHTG LVVPLDAANV DTDAIIPKQF LQKVTRTGFG AHLFNDWRFL DEKGQQPNPD        60
     FVLNFPQYQG ASILLARENF GCGSSREHAP WALTDYGFKV VIAPSFADIF YGNSFNNQLL       120
     PVKLSDAEVD ELFALVKANP GIHFDVDLEA QEVKAGEKTY RFTIDAFRRH CMMNGLDSIG       180
     LTLQHDDAIA AYEAKQPAFM N                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page