(data stored in ACNUC10821 zone)

EMBL: AP010958.MAK

AP010958.MAK         Location/Qualifiers
FT   CDS             416564..417472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ECO103_0369"
FT                   /product="manno (fructo) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29237"
FT                   /db_xref="GOA:C8U279"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C8U279"
FT                   /protein_id="BAI29237.1"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPV
FT                   RKAKHGDSSGVRGAAWLWPQE"
     MRIGIDLGGT KTEVIALGDA GEQLYRHRLP TPRDDYRQTI ETIATLVDMA EQATGQRGTV        60
     GMGIPGSISP YTGVVKNANS TWLNGQPFDK DLSARLQREV RLANDANCLA VSEAVDGAAA       120
     GAQTVFAVII GTGCGAGVAF NGRAHIGGNG TAGEWGHNPL PWMDEDELRY REEVPCYCGK       180
     QGCIETFISG TGFATDYRRL SGHALKGSEI IRLVEESDPV AELALRRYEL RLAKSLAHVV       240
     NILDPDVIVL GGGMSNVDRL YQTVGQLIKQ FVFGGECETP VRKAKHGDSS GVRGAAWLWP       300
     QE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page