(data stored in ACNUC10821 zone)

EMBL: AP010958.MBHA

AP010958.MBHA        Location/Qualifiers
FT   CDS             281953..282738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="ECO103_0247"
FT                   /product="flagellar system protein MbhA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29121"
FT                   /db_xref="GOA:C8U1W3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1W3"
FT                   /protein_id="BAI29121.1"
FT                   /translation="MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHP
FT                   PKPATVAVPEETEKKARDVNEKTALLKKKSATELGELATSITTIARDAHMEANLEMEIV
FT                   PQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKN
FT                   NIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDSKNPKSAGNRRIEIMV
FT                   LTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
     MTTIKLIVNS VSKSERESII AALHGQSIFN GGGLSPLNKI SPSHPPKPAT VAVPEETEKK        60
     ARDVNEKTAL LKKKSATELG ELATSITTIA RDAHMEANLE MEIVPQGLRV LIKDDQNRNM       120
     FERGSAQIMP FFKTLLVELA PVFDSLDNKI IITGHTDAMA YKNNIYNNWN LSGDRALSAR       180
     RVLEEAGMPE DKVMQVSAMA DQMLLDSKNP KSAGNRRIEI MVLTKSASDT LYQYFGQHGD       240
     KVVQPLVQKL DKQQVLSQRT R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page