(data stored in ACNUC10821 zone)

EMBL: AP010958.METQ

AP010958.METQ        Location/Qualifiers
FT   CDS             complement(220626..221441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ECO103_0197"
FT                   /product="DL-methionine transporter subunit MetQ"
FT                   /note="periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29073"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1R5"
FT                   /protein_id="BAI29073.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
     MAFKFKTFAA VGALIGSLAL VGCGQDEKDP NHIKVGVIVG AEQQVAEVAQ KVAKDKYGLD        60
     VELVTFNDYV LPNEALSKGD IDANAFQHKP YLDQQLKDRG YKLVAVGNTF VYPIAGYSKK       120
     IKSLDELQDG SQVAVPNDPT NLGRSLLLLQ KVGLIKLKDG VGLLPTVLDV VENPKNLKIV       180
     ELEAPQLPRS LDDAQIALAV INTTYASQIG LTPAKDGIFV EDKDSPYVNL IVTREDNKDA       240
     ENVKKFVQAY QSDEVYEAAN KVFNGGAVKG W                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page