(data stored in ACNUC10821 zone)

EMBL: AP010958.NUSB

AP010958.NUSB        Location/Qualifiers
FT   CDS             441453..441872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ECO103_0390"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29258"
FT                   /db_xref="GOA:C8U2A0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2A0"
FT                   /protein_id="BAI29258.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
     MKPAARRRAR ECAVQALYSW QLSQNDIADV EYQFLAEQDV KDVDVLYFRE LLAGVATNTA        60
     YLDGLMKPYL SRLLEELGQV EKAVLRIALY ELSKRSDVPY KVAINEAIEL AKSFGAEDSH       120
     KFVNGVLDKA APVIRPNKK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page