(data stored in SCRATCH zone)

EMBL: AP010958.PE220

AP010958.PE220       Location/Qualifiers
FT   CDS             complement(251551..252882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0220"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29096"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1T8"
FT                   /protein_id="BAI29096.1"
FT                   /translation="MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWG
FT                   FTELTLNNELLAQGKIMIDSASGTLLDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLA
FT                   LPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRIMSGAEDMSAY
FT                   ITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIG
FT                   SPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPSR
FT                   LPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQ
FT                   SATFVLAVAANVPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYH
FT                   SGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
     MATTRNKVMW QEGMLMRPHH FQQQQRYNDY LDNQRFRAMN DLSWGFTELT LNNELLAQGK        60
     IMIDSASGTL LDGTVFSIPD QDALPDPLHP QNFPDERSRN IYLALPVASD VRNEISDGRR       120
     IGRYRLNYAD VRDLHSEEGD ARTLTLGQLT PRIMSGAEDM SAYITLPLCR ISDRHADGSL       180
     TLDDDFIPSC QNIQVSKKLR VYLKEVQGAI GGRASDLANR IGSPAQSGIA DVAEFMMLQL       240
     LNRNQTRFTH RARRSQLHPE DFYLDLAGLL GELMTFTEPS RLPCPLDVYD HHDLTKTFKT       300
     LLPEVKRALH TVLSPRAVNL PLHLRDGIWQ ADIHDTELLQ SATFVLAVAA NVPVDQIQRQ       360
     FIQQSKISSP EKIRNMVSVQ IPGIPLRALM VAPRQLPYHS GFSYFELDKS GQAWTEMAAA       420
     GAVALHVSGS FPDLNMQLWA IRG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page