(data stored in ACNUC10821 zone)

EMBL: AP010958.PE225

AP010958.PE225       Location/Qualifiers
FT   CDS             complement(257611..258024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0225"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29101"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1U3"
FT                   /protein_id="BAI29101.1"
FT                   /translation="MIPDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILN
FT                   TRSGSCRGAPELGIDEPEGAENFRESMSRAIEQCIERYEPRISHAEVQAVVSSASSPLD
FT                   MTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD"
     MIPDRERTTG SLFERMEASS ARNRQGGSIH SLRQSIRQNL RNILNTRSGS CRGAPELGID        60
     EPEGAENFRE SMSRAIEQCI ERYEPRISHA EVQAVVSSAS SPLDMTFHIT AWVTFNETHE       120
     VLEFDMAPNG SQHYRVD                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page