(data stored in ACNUC10821 zone)

EMBL: AP010958.PE227

AP010958.PE227       Location/Qualifiers
FT   CDS             complement(259557..259781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0227"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29103"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1U5"
FT                   /protein_id="BAI29103.1"
FT                   /translation="MTAHKNISETYHLSVADILQVVYQVCFSPSVEINQDGVAALITTL
FT                   DRRISDLLDEIIHFCEFQQSASHWQRVLH"
     MTAHKNISET YHLSVADILQ VVYQVCFSPS VEINQDGVAA LITTLDRRIS DLLDEIIHFC        60
     EFQQSASHWQ RVLH                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page