(data stored in SCRATCH zone)

EMBL: AP010958.PE230

AP010958.PE230       Location/Qualifiers
FT   CDS             261741..263882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0230"
FT                   /product="VgrG protein"
FT                   /note="RhsG"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29106"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1U8"
FT                   /protein_id="BAI29106.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGMVTWFELGENDKNQMLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIESILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASDLHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQESSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQIQNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
     MSTGLRFTLE VDGLPPDAFA VVSFHLNQSL SSLFSLDLSL VSQQFLSLEF QQILDKMAYL        60
     TIWQGDDVQR RVKGMVTWFE LGENDKNQML YSMKVCPPLW RTGLRQNFRI FQNEDIESIL       120
     GTILQENGVT EWSPLFSEPH PSREFCVQYG ETDYDFLCRM AAEEGIFFYE EHAQKSTDQS       180
     LVLCDTVRYL PESFEIPWNP NTRTEVSTLC ISQFRYSAQI RPSSVVTKDY TFKRPGWAGR       240
     FDQEGQYQDY QRTQYEVYDY PGRFKGAHGQ NFARWQMDGW RNNAEVARGT SRSPEIWPGR       300
     RIVLTGHPQA NLNREWQVVA SDLHGEQPQA VPGRRGSGTT LDNHFAVIPA DRTWRPQPLL       360
     KPLVDGPQSA VVTGPAGEEI FCDEHGRVRV KFNWDRYNPS NQESSCWIRV AQAWAGTGFG       420
     NLAIPRVGQE VIVDFLNGDP DQPIIMGRTY HQENRTPGSL PGTKTQMTIR SKTYKGSGFN       480
     ELKFDDATGK EQVYIHAQKN MNTEVLNNRT TDVINNHAEK IGNNQAITVT NNQIQNIGVN       540
     QIQTVGVNQV ETVGSNQIIK VGSNQVEKVG IIRALTVGVA YQTTVGGIMN TSVALLQSSQ       600
     VGLHKSLMVG MGYSVNVGNN VTFSVGKTMK ENTGQTAVYS AGEHLELCCG KARLVLTKDG       660
     SIFLNGTHIH LEGESDVNGD APVINWNCGA TQPVPDAPVP KDLPPGMPDM RQF              713
//

If you have problems or comments...

PBIL Back to PBIL home page