(data stored in ACNUC10821 zone)

EMBL: AP010958.PE231

AP010958.PE231       Location/Qualifiers
FT   CDS             263958..268205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0231"
FT                   /product="fused putative RhsG core protein with
FT                   extension/putative RhsI core protein"
FT                   /note="RhsG/RhsI"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29107"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1U9"
FT                   /protein_id="BAI29107.1"
FT                   /translation="MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPNSPIE
FT                   EQKGNPVNPLLGAKVLPGETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFD
FT                   IRLQIRDEGLILNDSGGRSIHFEPLFPGEISYSRSESLWLARGGVAAQHSSQPLSALWQ
FT                   VLPEDVRLSPHVYLATNSLQGPWWILSWPERVPGADEVLPPEPPAYRVLTGVVDGFGRT
FT                   LAFHRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASS
FT                   SLVFPDTLPAGTGYGTDNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDR
FT                   SGTQVRGFTYDAEHAGRMVAHHYAGRPESCYRYDDTGRVTEQVNPEGLDYRFEYGESRV
FT                   IITDSLNRREVLYTEGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSL
FT                   HMASGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPDGLRSSREYDERGRLTAETSRSGET
FT                   TRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLAFTDCSGYTTRYEYDRYGQQIAVH
FT                   REEGISTYSSYNPRGQLVSQKDAQGREIRYEYSAAGDLTATVSPDGKRSTIEYDKRGRP
FT                   VSVTEGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLT
FT                   RKLTQSEDEGLITLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVH
FT                   YGYDDKGRLTGERQTVENPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSG
FT                   YLAGMKLGGTPLVEYTRDRLHRETVRSFGSRAGSNAAYELTSTYTPAGQLQSQHLNSLV
FT                   YDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLP
FT                   DPELHPDSTLTAWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPTGVIRTDDERTHHYHYD
FT                   SQHRLVFHTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGW
FT                   DGDRLTTVQTDTTRIQTVYQPGSFTPLIRVETENGEREKAQRRSLAEKLQQEGSEDGHG
FT                   VVFPAELVGLLDRLEGEIRANCVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYH
FT                   CDHRGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNR
FT                   HRYYDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGV
FT                   PGLIAANSITNSAYQFGYDMDAIVGGAHNGAADAMRHCYLMCRMTKTFGSTIADVIGKN
FT                   HEAAGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNTGQLFGLDGIKADNP
FT                   IKAKQGSSDASNY"
     MGGKPAARQG DMTRKGLDIV QGSAGVLIGA PTGVACSVCP NSPIEEQKGN PVNPLLGAKV        60
     LPGETDLALP GPLPFILSRA YSSYRTRTPA PVGVFGPGWK APFDIRLQIR DEGLILNDSG       120
     GRSIHFEPLF PGEISYSRSE SLWLARGGVA AQHSSQPLSA LWQVLPEDVR LSPHVYLATN       180
     SLQGPWWILS WPERVPGADE VLPPEPPAYR VLTGVVDGFG RTLAFHRAAE GDVAGAVTGV       240
     TDGAGRRFHL VLTTQAQRAE VFRKQRATSL SSPAGPRSAS SSLVFPDTLP AGTGYGTDNG       300
     IRLEAVWLTH DPAYPDEQPT APLARYTYTA GGELRAVYDR SGTQVRGFTY DAEHAGRMVA       360
     HHYAGRPESC YRYDDTGRVT EQVNPEGLDY RFEYGESRVI ITDSLNRREV LYTEGEGGLK       420
     RVVKKEHADG SITRSEYDEA GRLKAQTDAA GRRTEYSLHM ASGAVTAVTG PDGRTVRYGY       480
     NSQRQVTSVT YPDGLRSSRE YDERGRLTAE TSRSGETTRY SYDDPASELP TGIQDATGST       540
     KQMAWSRYGQ LLAFTDCSGY TTRYEYDRYG QQIAVHREEG ISTYSSYNPR GQLVSQKDAQ       600
     GREIRYEYSA AGDLTATVSP DGKRSTIEYD KRGRPVSVTE GGLTRSMGYD AAGRITVLTN       660
     ENGSQSTFRY DPVDRLTEQR GFDGRTQRYH YDLTRKLTQS EDEGLITLWH YDASDRITHR       720
     TVNGDPAEQW QYDEHGWLTT LSHTSEGHRV SVHYGYDDKG RLTGERQTVE NPETGELLWQ       780
     HETKHAYNEQ GLANRVTPDS LPPVEWLTYG SGYLAGMKLG GTPLVEYTRD RLHRETVRSF       840
     GSRAGSNAAY ELTSTYTPAG QLQSQHLNSL VYDRDYGWND NGDLVRISGP RQTREYGYSA       900
     TGRLESVRTL APDLDIRIPY ATDPAGNRLP DPELHPDSTL TAWPDNRIAE DAHYVYHYDE       960
     YGRLTEKTDR IPTGVIRTDD ERTHHYHYDS QHRLVFHTRI QHGEPLVESR YLYDPLGRRM      1020
     AKRVWRRERD LTGWMSLSRK PEETWYGWDG DRLTTVQTDT TRIQTVYQPG SFTPLIRVET      1080
     ENGEREKAQR RSLAEKLQQE GSEDGHGVVF PAELVGLLDR LEGEIRANCV SSESRQWLAQ      1140
     CGLTVERLAA QIEPVYLPER KIHLYHCDHR GLPLALISED GNTAWSAEYD EWGNQLNEEN      1200
     PHHLHQPYRL PGQQYDKESG LYYNRHRYYD PLQGRYITPD PIGLRGGWNM YQYPLNPIQV      1260
     IDPMGLDAIE NMTSGGLIYA VSGVPGLIAA NSITNSAYQF GYDMDAIVGG AHNGAADAMR      1320
     HCYLMCRMTK TFGSTIADVI GKNHEAAGDR QGQPAKERIM DLKNNTVGIA CGDFSAKCSD      1380
     ACIEKYNTGQ LFGLDGIKAD NPIKAKQGSS DASNY                                 1415
//

If you have problems or comments...

PBIL Back to PBIL home page