(data stored in ACNUC10821 zone)

EMBL: AP010958.PE250

AP010958.PE250       Location/Qualifiers
FT   CDS             284559..285698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0250"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29124"
FT                   /db_xref="GOA:C8U1W6"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1W6"
FT                   /protein_id="BAI29124.1"
FT                   /translation="MGNYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGM
FT                   PDLHPGRGYPIGAAFFSVGRFYPALVGNDIGCGMALWQTDILARKYNADKFEKRLSDLD
FT                   DVAEESWLEENLPSAFAQHPWRSSLGSIGGGNHFAELQQVDQIINAELFALAGLDAQHL
FT                   QLLVHSGSRGVGQSILQRHIASFSHHGLPQGSDDALRYIAEHDDALAFACINRQMIALR
FT                   IMQQVKATGSPVLDVAHNFVSACQIGDQQGWLHRKGATPDDNGLVIIPGSRGDYSWIVQ
FT                   PVANEKTLHSLAHGAGRKWGRTECKGRLAAKYTATQLSRTELGSRVICRDKQLIFEEAP
FT                   QAYKSAESVVQCLVQAGLIIPVARLRPVLTLKNSGGKKG"
     MGNYIRPLSD AVFTIASDDL WIESLAIQQL HTTANLPNMQ RVVGMPDLHP GRGYPIGAAF        60
     FSVGRFYPAL VGNDIGCGMA LWQTDILARK YNADKFEKRL SDLDDVAEES WLEENLPSAF       120
     AQHPWRSSLG SIGGGNHFAE LQQVDQIINA ELFALAGLDA QHLQLLVHSG SRGVGQSILQ       180
     RHIASFSHHG LPQGSDDALR YIAEHDDALA FACINRQMIA LRIMQQVKAT GSPVLDVAHN       240
     FVSACQIGDQ QGWLHRKGAT PDDNGLVIIP GSRGDYSWIV QPVANEKTLH SLAHGAGRKW       300
     GRTECKGRLA AKYTATQLSR TELGSRVICR DKQLIFEEAP QAYKSAESVV QCLVQAGLII       360
     PVARLRPVLT LKNSGGKKG                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page