(data stored in ACNUC10821 zone)

EMBL: AP010958.PE272

AP010958.PE272       Location/Qualifiers
FT   CDS             308784..309074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0272"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29145"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1Y7"
FT                   /protein_id="BAI29145.1"
FT                   /translation="MICQSVRCFNGLTCRTKWLWVFIPISDEKLNRYKYVICPVSPLRA
FT                   KLSEVKRRLPVVTGTMASLPGHCIQSSVRVTLTGTRTSAMGLPVDQAVPVA"
     MICQSVRCFN GLTCRTKWLW VFIPISDEKL NRYKYVICPV SPLRAKLSEV KRRLPVVTGT        60
     MASLPGHCIQ SSVRVTLTGT RTSAMGLPVD QAVPVA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page