(data stored in ACNUC10821 zone)

EMBL: AP010958.PE285

AP010958.PE285       Location/Qualifiers
FT   CDS             complement(324571..324783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0285"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29158"
FT                   /db_xref="GOA:C8U200"
FT                   /db_xref="UniProtKB/TrEMBL:C8U200"
FT                   /protein_id="BAI29158.1"
FT                   /translation="MDACLFHCKYPGITNARIFTEEQHNHDGTGLSQVVLNAIFNLVCL
FT                   LQVYVQISYLSQQSSIIRYTAFTGP"
     MDACLFHCKY PGITNARIFT EEQHNHDGTG LSQVVLNAIF NLVCLLQVYV QISYLSQQSS        60
     IIRYTAFTGP                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page