(data stored in ACNUC10821 zone)

EMBL: AP010958.PE292

AP010958.PE292       Location/Qualifiers
FT   CDS             332234..336217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0292"
FT                   /product="AidA-I adhesin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29163"
FT                   /db_xref="GOA:C8U205"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C8U205"
FT                   /protein_id="BAI29163.1"
FT                   /translation="MNKIYRLKWNRSRNCWSVCSELGSRVKGKKSRAVLISAISLYSSL
FT                   VFADDVIVNQDKAIDFGKENQSIDYRITVTDNANLVINTTDTSRPRLTLASGGGLDITG
FT                   GKVTINGPLNFLLKGTGFLNVSNAGSELYADDLYESNSGMRHDQGYFNVSNGGKIHVKG
FT                   TSRLTYTQGNVSGEGSQVNAGTFFMGVYGGYGGNQFLSVNNGGEVNAREHISLGYYDQR
FT                   SDTTLVVSDGGKISAPKISLSTNSELALGAQEGSAAKAAGIIDAEKIEFVWAKTSDKKI
FT                   TLNHTDKNATISADIVSGSEGLGYINALNGTTYLTGDNSAFSGKVKIEQNGALGITKNI
FT                   GTAEINNRGKLHLKADDSMTFANKISGNGTISIDSGTVALTGNNYAFSGYIDVASGAVA
FT                   VISEDKNIGRADLDVDGKLQINANKDWVFDNDLQGRGIVEINMGNHEFSFDEFAYTDWF
FT                   QGSLAFQNTTFNLEKNAEFLQRGGITAGQGSLVTVGKGAHSISTLGFSGGTVDFGALTA
FT                   GAQMTEGTVNVSKTLDLRGEGVIQVSDSDVVSSVSRDIDSALSLTEVDDGNSTIKLVDA
FT                   QGAEVLGDAGNLQLQDKNGQILSSSAQRDIQQNGQKAAVGTYDYRLTSGVNNDGLYIGY
FT                   GLTQLDLHATDSDALVLSSNGKSENAADLSAKITGSGDLAFSSQKDQTVSLSNKDNDYT
FT                   GVTDLRSGTLLLNNDNVLGNTHELRLAAETELDMNGHSQTVGTLNGSADSLLSLNGGSL
FT                   TVTNGGTSTGSLTGSGELNIQGGTLDIAGDNSNLTANVNIANSANVLVSHAQGLGSANV
FT                   ENNGTLALNNSAEKRAAASVNYTLGGNLTNNGTLMTGMSGQQAGNVLVVKGNYHGNNGQ
FT                   LVMNTVLNGDDSVTDKLVVEGDTSGTTAVTVNNAGGTGAKTLNGIELIHVDGKSEGEFV
FT                   QAGRIVAGAYDYTLARGQGANRGNWYLTSGSDSPELQPEPDPMPNPEPNPNPEPNPNPT
FT                   PTPGPDLNVDNDLRPEAGSYIANLAAANTMFTTRLHERLGNTYYTDMVTGEQKQTTMWM
FT                   RHEGGHNKWRDGSGQLKTQSNRYVLQLGGDVAQWSQNGSDSWHVGVMAGYGNSDSKTIS
FT                   SRTGYRAKASVNGYSTGLYATWYADDESRNGAYLDSWAQYSWFDNTVKGDDLQSESYKS
FT                   KGFTASLEAGYKHKLAEFNGNQGTRNEWYVQPQAQVTWMGVKADKHRESNGTLVHSNGD
FT                   GNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNWLHNSKDFSTSMDGVSVTQDGARNI
FT                   AEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAMVGIKWQF"
     MNKIYRLKWN RSRNCWSVCS ELGSRVKGKK SRAVLISAIS LYSSLVFADD VIVNQDKAID        60
     FGKENQSIDY RITVTDNANL VINTTDTSRP RLTLASGGGL DITGGKVTIN GPLNFLLKGT       120
     GFLNVSNAGS ELYADDLYES NSGMRHDQGY FNVSNGGKIH VKGTSRLTYT QGNVSGEGSQ       180
     VNAGTFFMGV YGGYGGNQFL SVNNGGEVNA REHISLGYYD QRSDTTLVVS DGGKISAPKI       240
     SLSTNSELAL GAQEGSAAKA AGIIDAEKIE FVWAKTSDKK ITLNHTDKNA TISADIVSGS       300
     EGLGYINALN GTTYLTGDNS AFSGKVKIEQ NGALGITKNI GTAEINNRGK LHLKADDSMT       360
     FANKISGNGT ISIDSGTVAL TGNNYAFSGY IDVASGAVAV ISEDKNIGRA DLDVDGKLQI       420
     NANKDWVFDN DLQGRGIVEI NMGNHEFSFD EFAYTDWFQG SLAFQNTTFN LEKNAEFLQR       480
     GGITAGQGSL VTVGKGAHSI STLGFSGGTV DFGALTAGAQ MTEGTVNVSK TLDLRGEGVI       540
     QVSDSDVVSS VSRDIDSALS LTEVDDGNST IKLVDAQGAE VLGDAGNLQL QDKNGQILSS       600
     SAQRDIQQNG QKAAVGTYDY RLTSGVNNDG LYIGYGLTQL DLHATDSDAL VLSSNGKSEN       660
     AADLSAKITG SGDLAFSSQK DQTVSLSNKD NDYTGVTDLR SGTLLLNNDN VLGNTHELRL       720
     AAETELDMNG HSQTVGTLNG SADSLLSLNG GSLTVTNGGT STGSLTGSGE LNIQGGTLDI       780
     AGDNSNLTAN VNIANSANVL VSHAQGLGSA NVENNGTLAL NNSAEKRAAA SVNYTLGGNL       840
     TNNGTLMTGM SGQQAGNVLV VKGNYHGNNG QLVMNTVLNG DDSVTDKLVV EGDTSGTTAV       900
     TVNNAGGTGA KTLNGIELIH VDGKSEGEFV QAGRIVAGAY DYTLARGQGA NRGNWYLTSG       960
     SDSPELQPEP DPMPNPEPNP NPEPNPNPTP TPGPDLNVDN DLRPEAGSYI ANLAAANTMF      1020
     TTRLHERLGN TYYTDMVTGE QKQTTMWMRH EGGHNKWRDG SGQLKTQSNR YVLQLGGDVA      1080
     QWSQNGSDSW HVGVMAGYGN SDSKTISSRT GYRAKASVNG YSTGLYATWY ADDESRNGAY      1140
     LDSWAQYSWF DNTVKGDDLQ SESYKSKGFT ASLEAGYKHK LAEFNGNQGT RNEWYVQPQA      1200
     QVTWMGVKAD KHRESNGTLV HSNGDGNVQT RLGVKTWLKS HHKMDDGKSR EFQPFVEVNW      1260
     LHNSKDFSTS MDGVSVTQDG ARNIAEIKTG VEGQLNANLN VWGNVGVQVA DRGYNDTSAM      1320
     VGIKWQF                                                                1327
//

If you have problems or comments...

PBIL Back to PBIL home page