(data stored in ACNUC10821 zone)

EMBL: AP010958.PE302

AP010958.PE302       Location/Qualifiers
FT   CDS             346485..346925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29172"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C8U214"
FT                   /protein_id="BAI29172.1"
FT                   /translation="MFFRNRKNIAMTIKEKFSQKYPHASFCTFGDSAALADHLATLIAT
FT                   GVKTASCGSLAGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTVELARK
FT                   EGEGDLSLEYWRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
     MFFRNRKNIA MTIKEKFSQK YPHASFCTFG DSAALADHLA TLIATGVKTA SCGSLAGCIE        60
     DNAFPMIGEY KIVENSRGEP VCVIRVIGLH LLRFSDVTVE LARKEGEGDL SLEYWRNEHR       120
     RFFQAEGSYS PEMDVIFEEY ALIDVV                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page