(data stored in ACNUC10821 zone)

EMBL: AP010958.PE303

AP010958.PE303       Location/Qualifiers
FT   CDS             347177..348163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0303"
FT                   /product="putative sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29173"
FT                   /db_xref="GOA:C8U215"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:C8U215"
FT                   /protein_id="BAI29173.1"
FT                   /translation="MMNKRFVINMVSSLLLGAALISAPLQAAEKVVVNISKVDGMPWFN
FT                   RMGEGVVEAGKAFGVNASQVGPSSTDAPQQVKIIEDLIARKVNAITIVPNDANVLEPVF
FT                   KKARDAGIVVLTNESPGQPSANWDIEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLT
FT                   VPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDDSRRTTLDLMKTYPDLKAVVSFG
FT                   SNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPASAGYALAAVA
FT                   STLLKGEEIKPGLEMQNLGKADVDMDKRIIRFHKVLLVNKDNIDSLY"
     MMNKRFVINM VSSLLLGAAL ISAPLQAAEK VVVNISKVDG MPWFNRMGEG VVEAGKAFGV        60
     NASQVGPSST DAPQQVKIIE DLIARKVNAI TIVPNDANVL EPVFKKARDA GIVVLTNESP       120
     GQPSANWDIE IIDNEKFAAE YVEHMAKRMG GKGGYVIYVG SLTVPQHNLW ADLLVKYQKE       180
     HYPDMHEVTR RMPVAESVDD SRRTTLDLMK TYPDLKAVVS FGSNGPIGAG RAVKEKRAKN       240
     KVAVYGMMIP SQAASLIKSG DITEGITYDP ASAGYALAAV ASTLLKGEEI KPGLEMQNLG       300
     KADVDMDKRI IRFHKVLLVN KDNIDSLY                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page