(data stored in ACNUC10821 zone)

EMBL: AP010958.PE35

AP010958.PE35        Location/Qualifiers
FT   CDS             complement(37236..37454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28915"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1A7"
FT                   /protein_id="BAI28915.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRITYSIKLADEKYPP"
     MTRFEAIKQG HIKIVDISIV CNFTVDKCEL NPAYVIKNID SPKDLLNGQK KRSSSENRIT        60
     YSIKLADEKY PP                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page