(data stored in ACNUC10821 zone)

EMBL: AP010958.PE403

AP010958.PE403       Location/Qualifiers
FT   CDS             complement(454381..454923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29271"
FT                   /db_xref="GOA:C8U2B3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2B3"
FT                   /protein_id="BAI29271.1"
FT                   /translation="MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASL
FT                   KKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEKQRVSGVLQGSQPSEIGVVRLVMLG
FT                   VARKYQKQGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSATPN
FT                   AFGAVPMFLAIQHILAA"
     MVDKHEEITL PIVLSCNYQS DITYPGQKQF DCGNPVIDKF VRASLKKSVR NSDCAAKALI        60
     DRQSGELIGI CTFTAYSLEK QRVSGVLQGS QPSEIGVVRL VMLGVARKYQ KQGFGQDLLC       120
     DFFEHVKIIH QALPIKGVYL DADPAAINFY ARLGFVQLSA TPNAFGAVPM FLAIQHILAA       180
//

If you have problems or comments...

PBIL Back to PBIL home page