(data stored in ACNUC10821 zone)

EMBL: AP010958.PE404

AP010958.PE404       Location/Qualifiers
FT   CDS             complement(454907..455218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29272"
FT                   /db_xref="GOA:C8U2B4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2B4"
FT                   /protein_id="BAI29272.1"
FT                   /translation="MPGKTATLPDVDKTLKNARVELKTSPDAKNKLREAAQAVGVDLSA
FT                   FILSAAMERAESVLDNQRRRELSNQSWELMNQLIAEPAQPTLALKALMKRKNSDGRQA"
     MPGKTATLPD VDKTLKNARV ELKTSPDAKN KLREAAQAVG VDLSAFILSA AMERAESVLD        60
     NQRRRELSNQ SWELMNQLIA EPAQPTLALK ALMKRKNSDG RQA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page