(data stored in ACNUC10821 zone)

EMBL: AP010958.PE510

AP010958.PE510       Location/Qualifiers
FT   CDS             complement(573357..573662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0510"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29377"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2L9"
FT                   /protein_id="BAI29377.1"
FT                   /translation="MTTFTNKELIKEIKERISSLEVRDDIERRAYEIALVSLEVEPDER
FT                   EAYELFMEKRFGDLVDRRRAKNGDNEYMAWDMTLGWIVWQQRAGIHFSTMSQQEVK"
     MTTFTNKELI KEIKERISSL EVRDDIERRA YEIALVSLEV EPDEREAYEL FMEKRFGDLV        60
     DRRRAKNGDN EYMAWDMTLG WIVWQQRAGI HFSTMSQQEV K                           101
//

If you have problems or comments...

PBIL Back to PBIL home page