(data stored in SCRATCH zone)

EMBL: AP010958.PE511

AP010958.PE511       Location/Qualifiers
FT   CDS             complement(573662..574024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0511"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29378"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M0"
FT                   /protein_id="BAI29378.1"
FT                   /translation="MRMNVFEMEGFLRGKCVPRDLKVNETNAEYLLRKFDALEAKCAAL
FT                   ENKIIPVSAELPPANESVLLFDANGEGWLIGWRSLWYTWGQKETGEWQWTFQVGDLENV
FT                   NITHWAVMPKAPEAGA"
     MRMNVFEMEG FLRGKCVPRD LKVNETNAEY LLRKFDALEA KCAALENKII PVSAELPPAN        60
     ESVLLFDANG EGWLIGWRSL WYTWGQKETG EWQWTFQVGD LENVNITHWA VMPKAPEAGA       120
//

If you have problems or comments...

PBIL Back to PBIL home page