(data stored in ACNUC10821 zone)

EMBL: AP010958.PE513

AP010958.PE513       Location/Qualifiers
FT   CDS             complement(574679..575503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0513"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29380"
FT                   /db_xref="InterPro:IPR019276"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M2"
FT                   /protein_id="BAI29380.1"
FT                   /translation="MSQNLDATAINQIHALISAQGVNEIISKIGADAVALPENFRIHDL
FT                   EKFNLNRFRFRGALSTASIDDFTRYSKDLADEGTRCFIDADNMRAVSVLNLGTIDEPGH
FT                   ADNTATLKLKKTAPFSALLSVNGERNSQKSLAEWIEDWADYLVGFDANGDAIQATKAAA
FT                   AVRKITIEANQTADFEDNDFSGKRSLMESVEAKTKDIMPVAFEFKCVPFEGLKERPFKL
FT                   RLSIITGDRPVLVLRIIQLEAVQEEMANEFRDLLVEKFKDSKVETFIGTFTA"
     MSQNLDATAI NQIHALISAQ GVNEIISKIG ADAVALPENF RIHDLEKFNL NRFRFRGALS        60
     TASIDDFTRY SKDLADEGTR CFIDADNMRA VSVLNLGTID EPGHADNTAT LKLKKTAPFS       120
     ALLSVNGERN SQKSLAEWIE DWADYLVGFD ANGDAIQATK AAAAVRKITI EANQTADFED       180
     NDFSGKRSLM ESVEAKTKDI MPVAFEFKCV PFEGLKERPF KLRLSIITGD RPVLVLRIIQ       240
     LEAVQEEMAN EFRDLLVEKF KDSKVETFIG TFTA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page