(data stored in ACNUC10821 zone)

EMBL: AP010958.PE514

AP010958.PE514       Location/Qualifiers
FT   CDS             complement(575569..575931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0514"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29381"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M3"
FT                   /protein_id="BAI29381.1"
FT                   /translation="MASERSTDVQAFIGELDGGVFETKIGAVLSEVASGVMNTKTKGKV
FT                   SLNLEIEPFDENRVKIKHKLSYVRPTNRGKISEEDTTETPMYVNRGGRLTILQEDQGQL
FT                   LTLAGEPDGKLRAAGR"
     MASERSTDVQ AFIGELDGGV FETKIGAVLS EVASGVMNTK TKGKVSLNLE IEPFDENRVK        60
     IKHKLSYVRP TNRGKISEED TTETPMYVNR GGRLTILQED QGQLLTLAGE PDGKLRAAGR       120
//

If you have problems or comments...

PBIL Back to PBIL home page