(data stored in ACNUC10821 zone)

EMBL: AP010958.PE518

AP010958.PE518       Location/Qualifiers
FT   CDS             578280..578831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0518"
FT                   /product="putative phage regulatory protein CII"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29385"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M7"
FT                   /protein_id="BAI29385.1"
FT                   /translation="MGKHHWKVEKQPEWYVKAVRKTIAALPGGYAEAADWLDVTENALF
FT                   NRLRADGDQIFPLGWAMILQRAGGTHFIADAVAQSANGVFVSLPDVEDVDNADINQRLL
FT                   EVIEQIGSYSKQIRSAIEDGVVEPHEKTAINDELYLSISKLQEHAALVYKIFCISESND
FT                   ARECAAPGAVACRDCGETNA"
     MGKHHWKVEK QPEWYVKAVR KTIAALPGGY AEAADWLDVT ENALFNRLRA DGDQIFPLGW        60
     AMILQRAGGT HFIADAVAQS ANGVFVSLPD VEDVDNADIN QRLLEVIEQI GSYSKQIRSA       120
     IEDGVVEPHE KTAINDELYL SISKLQEHAA LVYKIFCISE SNDARECAAP GAVACRDCGE       180
     TNA                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page