(data stored in SCRATCH zone)

EMBL: AP010958.PE519

AP010958.PE519       Location/Qualifiers
FT   CDS             578828..579166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0519"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29386"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M8"
FT                   /protein_id="BAI29386.1"
FT                   /translation="MNSLTTHYRRSQLIALPVPGGKAKVEYCYAVNVPGGRVIVTHSFA
FT                   EWAVGDFNRQKETVLCDKLTAGSKITTEYPSESFVGSRKHNELSTSAKAMSMSASARSN
FT                   SFVVNSGK"
     MNSLTTHYRR SQLIALPVPG GKAKVEYCYA VNVPGGRVIV THSFAEWAVG DFNRQKETVL        60
     CDKLTAGSKI TTEYPSESFV GSRKHNELST SAKAMSMSAS ARSNSFVVNS GK               112
//

If you have problems or comments...

PBIL Back to PBIL home page