(data stored in SCRATCH zone)

EMBL: AP010958.PE523

AP010958.PE523       Location/Qualifiers
FT   CDS             581258..581584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0523"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29390"
FT                   /db_xref="GOA:C8U2N2"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N2"
FT                   /protein_id="BAI29390.1"
FT                   /translation="MTTLTQCQQQVLDMLISYQQERGFPPTNQEVATMLGYRSVNAAVE
FT                   HLRALEKKGVITIKRGVARGITLHTAVKDDDSEAVGIIRALLAGEENARLRAAHWLHER
FT                   GLKV"
     MTTLTQCQQQ VLDMLISYQQ ERGFPPTNQE VATMLGYRSV NAAVEHLRAL EKKGVITIKR        60
     GVARGITLHT AVKDDDSEAV GIIRALLAGE ENARLRAAHW LHERGLKV                    108
//

If you have problems or comments...

PBIL Back to PBIL home page