(data stored in ACNUC10821 zone)

EMBL: AP010958.PE525

AP010958.PE525       Location/Qualifiers
FT   CDS             581990..582799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0525"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29392"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N4"
FT                   /protein_id="BAI29392.1"
FT                   /translation="MNNLMVIDGIEVRRDAYGRYSLNDLHRAAVASGANARTKEPGKFL
FT                   SSQQTVELVHELTNTQNLGVDPVSVIHGGNERGTYVCKELVYAYAMWISPSFHLKVIRT
FT                   FDMVTSAPEKLSGQAADKMQAGVILLDFMRRELNLSNSSVLGACQKLQEAVGLPNLAPR
FT                   YAIDAPADAHDGSSRPTLSLSALLKQYGIRLTANQAYHQMVKLGIVEQRERYSRTAINN
FT                   IKKFWSLTAKGCMFGKNITSPANPRETQPHFFESRFPELLKLLDTVH"
     MNNLMVIDGI EVRRDAYGRY SLNDLHRAAV ASGANARTKE PGKFLSSQQT VELVHELTNT        60
     QNLGVDPVSV IHGGNERGTY VCKELVYAYA MWISPSFHLK VIRTFDMVTS APEKLSGQAA       120
     DKMQAGVILL DFMRRELNLS NSSVLGACQK LQEAVGLPNL APRYAIDAPA DAHDGSSRPT       180
     LSLSALLKQY GIRLTANQAY HQMVKLGIVE QRERYSRTAI NNIKKFWSLT AKGCMFGKNI       240
     TSPANPRETQ PHFFESRFPE LLKLLDTVH                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page