(data stored in ACNUC10821 zone)

EMBL: AP010958.PE526

AP010958.PE526       Location/Qualifiers
FT   CDS             582807..583796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0526"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29393"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR010373"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N5"
FT                   /protein_id="BAI29393.1"
FT                   /translation="MRALLTPEIAPRMGIVLFRPGSELMPLFMQGRVLLEPEPERYSSF
FT                   ASGAVPAASQPLADDPAVRAVFRNEAVIRRAGGVECLESWLLREKGCQWPHSDWHSENM
FT                   TTMRHAPGAIRLCWHCDNQLRDQFTERLESMATDNCARWVLSVVRRDLGFDDSHVVTMP
FT                   ELCWWLIRNDLADALPESAARKALRLPKPVVPSVTRESDLVPSVPATSIIQDKAKKVLA
FT                   LKVDPESPESFMLRPKRRRWVNEKYTRWVKTQPCACCGKPADDPHHLIGHGQGGMGTKA
FT                   HDLFVLPLCRKHHDELHADTVAFEEKYGSQLELIFRFIDRALAIGVLA"
     MRALLTPEIA PRMGIVLFRP GSELMPLFMQ GRVLLEPEPE RYSSFASGAV PAASQPLADD        60
     PAVRAVFRNE AVIRRAGGVE CLESWLLREK GCQWPHSDWH SENMTTMRHA PGAIRLCWHC       120
     DNQLRDQFTE RLESMATDNC ARWVLSVVRR DLGFDDSHVV TMPELCWWLI RNDLADALPE       180
     SAARKALRLP KPVVPSVTRE SDLVPSVPAT SIIQDKAKKV LALKVDPESP ESFMLRPKRR       240
     RWVNEKYTRW VKTQPCACCG KPADDPHHLI GHGQGGMGTK AHDLFVLPLC RKHHDELHAD       300
     TVAFEEKYGS QLELIFRFID RALAIGVLA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page